Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c7d62A_

Fold library idPDB HeaderMoleculeTitle
c7d62A_1.90PDB header: signaling proteinChain: A: PDB Molecule: pggh;


Added to library: Sat Oct 31 08:30:48 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KYRLVTRSDFDGLVCAVLLKSIELIDDIQFVHPKDMQDGKVPITERDIITNLPYVANAHLVFDHHHRPNH
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)

SSTT


TT
S


TTSS


TT
S



TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence IINPNAPSAARVVWEHYGGTKTFPFEWVEMMEAVDKGDSAQFTRDEVLDSTGWNLLNFLMDARTGLGNFR
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
TT
S
TTGGGTS
GGGTTTTTT


SS


GGG




S
 .........150.........160.........170.........180.........190.........200.........210
Sequence ISNYNLMMALIDHCTHASIDEILQLPDVKERVELYRKHETLFKEQIQRCGKVYQNLVLLDLTEEETIYAG
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) S
TTS
TSTT
TT
S




 .........220.........230.........240.........250.........260.........270.........280
Sequence NRFIIYALYPQCNISIHKMWGFQKQNIVFATGKSIFDRSSRTNIGELMLKYGGGGHAAAGTCQIAIEDAD
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
TT
TT
S
GGGSS
SSS





TTT
TT
GGG
 .........290....
Sequence RVEKALITQINADG
Predicted secondary structure

SS confidence













Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D