Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c7cyzB_

Fold library idPDB HeaderMoleculeTitle
c7cyzB_2.10PDB header: lipid binding proteinChain: B: PDB Molecule: oxysterol-binding protein-related protein 3;


Added to library: Sat Oct 31 09:27:54 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RRRTLPAPCPSSSNISLWNILRNNIGKDLSKVAMPVELNEPLNTLQRLCEELEYSELLDKAAQIPSPIER
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)





S



TTTSTTS
GGGS


GGGGGGTTTTT
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence MVYVAAFAISAYASSYYRAGSKPFNPVLGETYERIREDKGFQFFSEQVSHHPPISACHAESRNFVFWQDV
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTTTTT



TT
TTTTTTSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence RWKNKFWGKSMEIVPIGTTHVTLPVFGDHFEWNKVTSIHNILSGQRWIEHYGEIVIKNLHDDSCYCKVNF
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)


SS


STTTT

B

BTTTSSS
B


BSTT
TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence IKAKYWSTNAHEIEGTVFDRSGKAVHRLFGKWHESIYGGGSSSACVWRANPMPKGYEQYYSFTQFALELN
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)



TTSTTTTTTS
TTT


SS









TTGGGGTT

T
 .........290.........300.........310.........320.........330.........340.........350
Sequence EMDPSSKSLLPPTDTRFRPDQRFLEEGNLEEAEIQKQRIEQLQRERRRVLEENHVEHQPRFFRKSDDDSW
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)


TTGGGGS
TTBGGG
TT
TT




SS
TTS
 .........360.........370....
Sequence VSNGTYLELRKDLGFSKLDHPVLW
Predicted secondary structure













SS confidence























Known secondary structure (DSSP)
S
GGGTTTTS






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D