Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c7a23a_

Fold library idPDB HeaderMoleculeTitle
c7a23a_3.70PDB header: membrane proteinChain: A: PDB Molecule: 51kda;


Added to library: Sat Oct 31 09:01:27 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LIVFLPLLGSSVAGFFGRFLGSEGSAIMTTTCVSFSSILSLIAFYEVALGASACYLRIAPWISSEMFDAS
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)

S
S
SS
SSS

SSS




TGGGGG







B




SSS
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence WGFLFDSLTVVMLIVVTSISSLVHLYSISYMSEDPHSPRFMCYLSIFTFFMLMLVTGDNFLQLFLGWEGV
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) B




SS
SSSTTT
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence GLASYLLIHFWFTRLQADKAAIKAMLVNRVGDFGLALGILGCFTLFQTVDFSTIFACASVPMRLNAISLI
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TSS


ST



TTT



S
 .........220.........230.........240.........250.........260.........270.........280
Sequence CILLFIGAVGKSAQIGLHTWLPDAMEGPTPVSALIHAATMVTAGVFMIARCSPLFEYSPTALIVITSAGA
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) S

SSSS
SSTTTTTTS
TTTTTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence MTSFLAATTGILQNDLKRVIAYSTCSQLGYMIFACGISNYSVSVFHLMNHAFFKALLFLSAGSVIHAMSD
Predicted secondary structure

SS confidence





































































Known secondary structure (DSSP)





SSTTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence EQDMRKMGGLASSFPLTYAMMLIGSLSLIGFPFLTGFYSKDVILELAYTKYTISGNFAFWLGSVSVLFTS
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP)




SSSSSS
SS
TTTTTSS
TTTSBTTBT

SSTTTS


 .........430.........440.........450.........460.........470.........480.........490
Sequence YYSFRLLFLDISRCHDAPIPMAIPLILLALGSNFWANSLLVLPKNEILAESEFAAPTIIKLIPILFSTLG
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)





S

S


TTTSS


SS


SS
S

SGGGT
 .........500.........510.........520.........530.........540.........550.........560
Sequence AFVAYNVNPVADQFQRAFQTSTFCNRLYSFFNKRWFFDQVLNDFLVRSFLRFGYEVSFEALDKGAIEILG
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) GGGSS

S
TT
SS
STT

TTSSTTSTT
TT
 .........570.........580.........590.........600
Sequence PYGISYTFRRLAERISQLQSGFVYHYAFAMLLGLTLFVTF
Predicted secondary structure



SS confidence







































Known secondary structure (DSSP) GGG
ST


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D