Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6vp9B_

Fold library idPDB HeaderMoleculeTitle
c6vp9B_3.46PDB header: transferaseChain: B: PDB Molecule: n-alpha-acetyltransferase 25, natb auxiliary subunit;


Added to library: Sat Sep 26 08:55:53 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RRLRPIYDYLDNGNNKMAIQQADKLLKKHCAKVLKAIGLQRTGKQEEAFTLAQEVAALEPTDDNSLQALT
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)
TTTGGGSSSSTTTTTTTT


STT
SS
STTS



 .........80.........90.........100.........110.........120.........130.........140
Sequence ILYREMHRPELVTKLYEAAVKKVPNSEEYHSHLFMAYARVGEYKKMQQAGMALYKIVPKNPYYFWSVMSL
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TT

TT


SST
S

 .........150.........160.........170.........180.........190.........200.........210
Sequence IMQSISAQDENLSKTMFLPLAERMVEKMVKEDKIEAEAEVELYYMILERLGKYQEALDVIRGKLGEKLTS
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) SS
SSGGGTSSSTTT


SST
SSTTGGG
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence EIQSRENKCMAMYKKLSRWPECNALSRRLLLKNSDDWQFYLTYFDSVFRLIEEAWSPPAEGEHSLEGEVH
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) SSSTTTTTT

S

T



SSSSSSSSS


 .........290.........300.........310.........320.........330.........340.........350
Sequence YSAEKAVKFIEDRITEESKSSRHLRGPHLAKLELIRRLRSQGCNDEYKLGDPEELMFQYFKKFGDKPCCF
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)
STSSS

STT
SS


SS

S
SSTTS
 .........360.........370.........380.........390.........400.........410.........420
Sequence TDLKVFVDLLPATQCTKFINQLLGVVPLSTPTEDKLALPADIRALQQHLCVVQLTRLLGLYHTMDKNQKL
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) STTGGGS
SSGGGTTTTS



STTTS




SSTT
SSSS
SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence SVVRELMLRYQHGLEFGKTCLKTELQFSDYYCLLAVHALIDVWRETGDETTVWQALTLLEEGLTHSPSNA
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TTSTTTT

SSS

TTTTTTTT

SSSSTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence QFKLLLVRIYCMLGAFEPVVDLYSSLDAKHIQHDTIGYLLTRYAESLGQYAAASQSCNFALRFFHSNQKD
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) T

TTTT

TTTTTTTTT
 .........570.........580.........590.........600.........610.........620.........630
Sequence TSEYIIQAYKYGAFEKIPEFIAFRNRLNNSLHFAQVRTERMLLDLLLEANISTSLAESIKSMNLRPEEDD
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) TTTTTT

SSS
SSSSS
TTT

TT


 .........640.........650.........660.........670.........680.........690.........700
Sequence IPWEDLRDNRDLNVFFSWDPKDRDVSEEHKKLSLEEETLWLRIRSLTLRLISGLPSLNHRIDILRLLLQQ
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)

SSS





S

S


S
SSSS

TTSTTS


T
 .........710.........720.........730.........740.........750.........760.........770
Sequence LEATLETGKRFIEKDIQYPFLGPVPTRMGGFFNSGCSQCQISSFYLVNDIYELDTSGLEDTMEIQERIEN
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) S




TTS



TTT

SSS
 .........780.........790.........800.........810.........820.........830.........840
Sequence SFKSLLDQLKDVFSKCKGDLLEVKDGNLKTHPTLLENLVFFVETISVILWVSSYCESVLRPYKLNLIIMP
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
S
SB

GGG


B
S


S
 .........850.........860.........870.........880.........890.........900.........910
Sequence PVFTSFQDYVTGLQTLISNVVDHIKGLETHLISPEERKFSKTVQGKVQSSYLHSLLEMGELLKKRLETTK
Predicted secondary structure





SS confidence





































































Known secondary structure (DSSP) TT
TTT



TTGGGG
 ....
Sequence KLKI
Predicted secondary structure


SS confidence



Known secondary structure (DSSP) SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D