Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6vkmA_

Fold library idPDB HeaderMoleculeTitle
c6vkmA_3.50PDB header: viral proteinChain: A: PDB Molecule: virion spike glycoprotein;


Added to library: Sat Apr 18 08:23:51 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence IPLGVIHNSALQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSVTKRWGFRSGVPPKVVNYEAG
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)


TT

SS


TT



SGGGGGGGT


SGGG
S




SB
 .........80.........90.........100.........110.........120.........130.........140
Sequence EWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYR
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

TTS
B
S



TT



S




SSTTS

SSSS

T
 .........150.........160.........170.........180.........190.........200.........210
Sequence GTTFAEGVVAFLILPQAKKDSTTIRYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYASG
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) T

B

SSS


STTSSS
SSSS

TT

TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence KRSNTTGKLIWKVNPEIDTAFWETEVIVNAQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYTEGL
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)



SS




TTS



TT

B



SS







TTTTTT

STTTS

TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence MHNQDGLICGLRQLANETTQALQLFLRATPELRTFSILNRFAIDFLLQRWGGTCHILGPDCCIEPHDWTK
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)

GGG


S

SS


TTSTT




 ...
Sequence NIT
Predicted secondary structure


SS confidence


Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D