Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6m5uB_

Fold library idPDB HeaderMoleculeTitle
c6m5uB_3.80PDB header: viral proteinChain: B: PDB Molecule: tripartite terminase subunit 1;


Added to library: Sat Oct 31 08:32:55 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AAPVSEPTVARQKLLALLGQVQTYVFQIELLRRCDPHIGRGKLPQLKLNALQVRALRRRLRPGLEAQAGA
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP)




TTS
TTSTTTSTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence FLTPLSVTLELLLEYAWREGERLLGSLETFATAGDVAAFFTETMGLARPCPYHQRVRLDTYGGTVHMELC
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)


TTTS

TTSSS









SSS




 .........150.........160.........170.........180.........190.........200.........210
Sequence FLHDVENFLKQLNYCHLITPSRGATAALERVREFMVGAVGSGLIVPPELSDPSHPCAVCFEELCVTANQG
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) STTTTS
TSS
SS

GGG

TTS

TTS

SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence ATIASRLADRICNHVTQQAQVRLDANELRRYLPHAAGLSDADRARALSVLDHALAYAISELQFWLASGDR
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

GGGTTTT



SSS







SSSTT
SS

T


GGGGTTS


S
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence AGQTTMDAFASNLTALARRELQQETAAVAVELALFGRRAEHFDRAFGSHLAALDMVDALIIGGQATSPDD
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) SSS
TSS



TTTSSTTTSS
S
S

SSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence QIEALIRACYDHHPLLRRLVSPEQCDEEALRRVLARWGDIATQAAADVRERRRLYADRLTKRSLASLGRC
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) SS






S
 .........430.........440.........450.........460.........470.........480.........490
Sequence VREQRGELEKMLRVSVHGEVLPATFAAVANGFAARARFCALTAGAGTVIDNRSAPGVFDAHRFMRASLLR
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) S




SSTSSSS
SSS
SSTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence HQVDPALLPSITHRFFELVNGPLFDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFIMGGADWAVSE
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) S


GGGS
SS


SSSSS


SS


TTS



SS

S
 .........570.........580.........590.........600.........610.........620.........630
Sequence FQRFYCFDGISGITPTQRAAWRYIRELIIATTLFASVYRCGELELRRPDCSRPTSEGRYRYPPGVYLTYD
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) SS
SS

SS

SS

S


TT

TT




SSS




S
TT
 .........640.........650.........660.........670
Sequence SDCPLVAIVESAPDGCIGPRSVVVYDRDVFSILYSVLQHL
Predicted secondary structure



















SS confidence







































Known secondary structure (DSSP) TTS
S


SSSS

TT

S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D