Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6lt0C_

Fold library idPDB HeaderMoleculeTitle
c6lt0C_3.20PDB header: protein bindingChain: C: PDB Molecule: guanine nucleotide exchange c9orf72;


Added to library: Sat Apr 18 08:25:52 2020
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AKTEIALSGKSPLLAATFAYWRVRHIWAPKTEQVLLSDGEITFLANHTLNGEIGAIDVKFFVLSEKGVII
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)


SS

S

B
BB




S


SS
SS
SSS




TTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence VSLIFTYGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKEIIPMLTGEVIPVMELLSSMKSHSV
Predicted secondary structure




SS confidence





































































Known secondary structure (DSSP)


TT
STTTGGG



TS
 .........150.........160.........170.........180.........190.........200.........210
Sequence PEEIDIADTVLNDDDIGDSCHEGFLLNAISSHLQTCGCSVVVGSSAEKVNKIVRTLCLFLTPAERKCSRL
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
SS

GGGSSTTSSSS
SSSTTT

SSSGGGS



 .........220.........230.........240.........250.........260.........270.........280
Sequence CEAESSFKYESGLFVQGLLKDSTGSFVLPFRQVMYAPYPTTHIDVDVNTVKQMPPCHEHIYNQRRYMRSE
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

SSS




SS
S




TTS




TSSS

TTTT



 .........290.........300.........310.........320.........330.........340.........350
Sequence LTAFWIFQDVLHRDTLVKAFLDQVFQLKPGLSLRSTFLAQFLLVLHRKALTLIKYIEDDTQKGKKPFKSL
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) STT



B




STTS
STTS
TTSSSS



 .........360.........370.........380.....
Sequence RNLKIDLDLTAEGDLNIIMALAEKIKPGLHSFIFG
Predicted secondary structure








SS confidence


































Known secondary structure (DSSP) TT

STSTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D