Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6f42W_

Fold library idPDB HeaderMoleculeTitle
c6f42W_5.50PDB header: transcriptionChain: W: PDB Molecule: transcription factor tfiiib component b'';


Added to library: Sat Jan 20 10:44:02 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence CKPNFPIGQISENFEKSKMAKKAKLEKRRHLRELRMRARQEKVDENPFANLYNYGSYGRGSYTDPWTVEE
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)

SSS


S

TT







TTSS


SSSS
S







 .........80.........90.........100.........110.........120.........130.........140
Sequence MIKFYKALSMWGTDFNLISQLYPYRSRKQVKAKFVNEEKKRPILIELALRSKLPPNFDEYCCEIKKNIGT
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) SSS
STT

TT


S

SS
STT
 .........150.........160.....
Sequence VADFNEKLIELQNEHKHHMKEIEEA
Predicted secondary structure
SS confidence
























Known secondary structure (DSSP)


SSSSSS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D