Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6eqtA_

Fold library idPDB HeaderMoleculeTitle
c6eqtA_2.74PDB header: dna binding proteinChain: A: PDB Molecule: centromere protein n;


Added to library: Sat Jan 20 10:21:44 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MDETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLD
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)

S
T
S
T


SS
T

 .........80.........90.........100.........110.........120.........130.........140
Sequence IIYMQFHQHQKVWDVFQMSKDLFDMKQFKNSFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQ
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) T
GGGS



S
SSSTTT

SSS


T
 .........150.........160.........170.........180.........190.........200.......
Sequence YKPTYVVYYSQTPYAFTSSSMLRRNTPLLGQALTIASKHHQIVKMDLRSRYLDSLKAIVFKQYNQTF
Predicted secondary structure






















SS confidence


































































Known secondary structure (DSSP) TS
TTSS
SS

TTTT
SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D