Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6eqtA_

Fold library idPDB HeaderMoleculeTitle
c6eqtA_2.74PDB header: dna binding proteinChain: A: PDB Molecule: centromere protein n;


Added to library: Sat Jan 20 10:21:44 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MDETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLD
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)

S
T
S
T


SS
T

 .........80.........90.........100.........110.........120.........130.........140
Sequence IIYMQFHQHQKVWDVFQMSKDLFDMKQFKNSFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQ
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) T
GGGS



S
SSSTTT

SSS


T
 .........150.........160.........170.........180.........190.........200.......
Sequence YKPTYVVYYSQTPYAFTSSSMLRRNTPLLGQALTIASKHHQIVKMDLRSRYLDSLKAIVFKQYNQTF
Predicted secondary structure






















SS confidence


































































Known secondary structure (DSSP) TS
TTSS
SS

TTTT
SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D