Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5y2aA_

Fold library idPDB HeaderMoleculeTitle
c5y2aA_1.90PDB header: hydrolaseChain: A: PDB Molecule: insect group ii chitinase;


Added to library: Sat Jan 20 10:47:47 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ERFKVVCYYTNWAWYRPDNGKYTPGDINPELCTHIIYAFAVLDKEELVIKSHDIWLDVENKFYEKVTALK
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)

SGGGGSS
TTT


GGG

GGG
S
TTT
SS
TTT
GGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence SHGVKVLLGLGGWDDSAGDKYSRLVNNVSARRKFVVHAVDFLEQYGFDGLDLDWEYPKCWQVECEKGPDS
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) GGT

TGGGSSST
T


S
SSSBTTBTTTS
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence DKQGFADLVKELRKAFNRRGMLLSAAVSASKRVIDYAYNVPALSMNLDWISLMTYDYHGQWDKKTGHVAP
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) T






S



SS
GGGSB


SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence MYVHDKDTDNTFNVNFTVNYWINKGADRKKLVVGVPFYGQSFSVVEGAGTGLGAPTYAGGEAGDETRARG
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)
S

TT
S
TTSSTT

GGGS
TTS
SSTT
B



TTT

TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence FLSFYEICERVKVKGWKVHRDPGGRIGPYATHDDQWVSFDDDFMARHKAEYVRAMELGGSMAWSLDLDDF
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TT



TTSSS

TT


TT
S
GGGS
T
 .........360.........370.........380...
Sequence TGKYCGCGKAPLLTTINHVLRGKEAPPPCILHE
Predicted secondary structure






















SS confidence
































Known secondary structure (DSSP) TSTTTSS
SS








TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D