Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5y2aA_

Fold library idPDB HeaderMoleculeTitle
c5y2aA_1.90PDB header: hydrolaseChain: A: PDB Molecule: insect group ii chitinase;


Added to library: Sat Jan 20 10:47:47 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ERFKVVCYYTNWAWYRPDNGKYTPGDINPELCTHIIYAFAVLDKEELVIKSHDIWLDVENKFYEKVTALK
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)

SGGGGSS
TTT


GGG

GGG
S
TTT
SS
TTT
GGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence SHGVKVLLGLGGWDDSAGDKYSRLVNNVSARRKFVVHAVDFLEQYGFDGLDLDWEYPKCWQVECEKGPDS
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) GGT

TGGGSSST
T


S
SSSBTTBTTTS
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence DKQGFADLVKELRKAFNRRGMLLSAAVSASKRVIDYAYNVPALSMNLDWISLMTYDYHGQWDKKTGHVAP
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) T






S



SS
GGGSB


SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence MYVHDKDTDNTFNVNFTVNYWINKGADRKKLVVGVPFYGQSFSVVEGAGTGLGAPTYAGGEAGDETRARG
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)
S

TT
S
TTSSTT

GGGS
TTS
SSTT
B



TTT

TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence FLSFYEICERVKVKGWKVHRDPGGRIGPYATHDDQWVSFDDDFMARHKAEYVRAMELGGSMAWSLDLDDF
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TT



TTSSS

TT


TT
S
GGGS
T
 .........360.........370.........380...
Sequence TGKYCGCGKAPLLTTINHVLRGKEAPPPCILHE
Predicted secondary structure






















SS confidence
































Known secondary structure (DSSP) TSTTTSS
SS








TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D