Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5wvbA_

Fold library idPDB HeaderMoleculeTitle
c5wvbA_3.10PDB header: hydrolaseChain: A: PDB Molecule: chitinase;


Added to library: Sat Dec 30 08:32:23 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DGYKIVCYYTNWSQYRTKIGKFMPEDIQPELCTHIIFAFGWLKKGKLSSFESNDETKDGKTGLYDRINAL
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

STTGGG

GGG


GGGS
TTT
STT
SSGGGS

SSS

T
 .........80.........90.........100.........110.........120.........130.........140
Sequence KKANPKLKTLLAIGGWSFGTQKFKEMSATRYARQTFIYSAIPYLRDRNFDGLDIDWLYPKGGDDKKNYVL
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
TT

STT
SSSTTT


S


 .........150.........160.........170.........180.........190.........200.........210
Sequence LLKELREAFEAEAQEVKKPRLLLTAAVPVGPDNIKSGYDVPAVASYLDFINLMAYDFHGKWERETGHNAP
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TS








S



SS
TTSSB


SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LYAPSSDSEWRKQLSVDHAAHLWVKLGAPKEKLIIGMPTYGRTFTLSNPNNFKVNSPASGGGKAGEYTKE
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) SS

SSS
TTGGG
ST

GGGSSSTT

STT
B




TTT

 .........290.........300.........310.........320.........330.........340.........350
Sequence SGFLAYYEVCEILRNGGAYVWDDEMKVPYAIHGDQWVGFDDEKSIRNKMRWIKDNSFGGAMVWTVDMDDF
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TTTTT
TTTTTT


T


GGGS

 .........360.........370.........380.........390.
Sequence SGGVCGGNVKYPLIGAMREELRGISRGKDAKDVDWASVAAS
Predicted secondary structure































SS confidence








































Known secondary structure (DSSP) SSSSSSS

SS




TT




SB


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D