Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5wvbA_

Fold library idPDB HeaderMoleculeTitle
c5wvbA_3.10PDB header: hydrolaseChain: A: PDB Molecule: chitinase;


Added to library: Sat Dec 30 08:32:23 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DGYKIVCYYTNWSQYRTKIGKFMPEDIQPELCTHIIFAFGWLKKGKLSSFESNDETKDGKTGLYDRINAL
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

STTGGG

GGG


GGGS
TTT
STT
SSGGGS

SSS

T
 .........80.........90.........100.........110.........120.........130.........140
Sequence KKANPKLKTLLAIGGWSFGTQKFKEMSATRYARQTFIYSAIPYLRDRNFDGLDIDWLYPKGGDDKKNYVL
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
TT

STT
SSSTTT


S


 .........150.........160.........170.........180.........190.........200.........210
Sequence LLKELREAFEAEAQEVKKPRLLLTAAVPVGPDNIKSGYDVPAVASYLDFINLMAYDFHGKWERETGHNAP
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TS








S



SS
TTSSB


SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LYAPSSDSEWRKQLSVDHAAHLWVKLGAPKEKLIIGMPTYGRTFTLSNPNNFKVNSPASGGGKAGEYTKE
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) SS

SSS
TTGGG
ST

GGGSSSTT

STT
B




TTT

 .........290.........300.........310.........320.........330.........340.........350
Sequence SGFLAYYEVCEILRNGGAYVWDDEMKVPYAIHGDQWVGFDDEKSIRNKMRWIKDNSFGGAMVWTVDMDDF
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TTTTT
TTTTTT


T


GGGS

 .........360.........370.........380.........390.
Sequence SGGVCGGNVKYPLIGAMREELRGISRGKDAKDVDWASVAAS
Predicted secondary structure































SS confidence








































Known secondary structure (DSSP) SSSSSSS

SS




TT




SB


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D