Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5urpA_

Fold library idPDB HeaderMoleculeTitle
c5urpA_1.65PDB header: toxinChain: A: PDB Molecule: toxin 2a;


Added to library: Sat Dec 23 08:28:57 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MIDFRIDKEKAKKWGKKEYSKWKSTLTEEEKRQITLYTRNASPINTYLREEGIGSKPDMDKKIELIDKAL
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)
B

TT
TT



T
TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence IKTKLKDSVTVYRGTDGIIFGKEFQNTLMNGNKVNGEVAKKIKKEFEGTMLLERGYLSTSLVNGTLFLAR
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) TT


SS

GGGG
TTTTTSSTT
TT
SS
SS

GGGGGS
 .........150.........160.........170.........180.........190.........200.
Sequence PVLIELKIPKGGNAGYVDPISYYPGQLEMLLPRDTKYYIDNIKIIVNGGSQRLKVEARVLS
Predicted secondary structure






















SS confidence




























































Known secondary structure (DSSP) S
TT



GGG
SSTTS

TT

TTS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D