Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5mdoF_

Fold library idPDB HeaderMoleculeTitle
c5mdoF_1.95PDB header: sugar binding proteinChain: F: PDB Molecule: chitoporin;


Added to library: Sat Dec 23 08:28:03 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EYLTKDSFSYEVYGIIAXQAAYRDYDSGDAKQDDNLGGXQLNNESRIGFRGKKQFANFEPTFIWQIEGGY
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)



GGG
S
SS





TT
SSB

 .........80.........90.........100.........110.........120.........130.........140
Sequence VDPSFGGEGAGLGERDTFVGFESASWGQVRLGRVLTPXYELVDWPASNPGLGDVYDWGGAIGGAKYQDRQ
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) SB
TTS
S


BTSSSTTT
TTTTTTTTTS



SS
S


 .........150.........160.........170.........180.........190.........200.........210
Sequence SNTIRWDSPXYADKFSIDAAVGAGDKAGLGAGDDYWGGIAAHYKLGPLQLDAAYEGNRNIEAEGQTWENN
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)


BTTT
TTGGGTS


TTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence TYLVGVQGWFENGISFFAQYKYXEADASNGVNEKQDAXSAGLXYTTGDWQYKLGYAANFDLERDGKTLSN
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
TTSTTS
TT


TT
TT
 .........290.........300.........310.........320.........330.........340.
Sequence TSDDVVSAQIXYFVDPSAVLYARARXNDFNEGLDGLDDAARWTSGTNGDYNEYSVGVEYYF
Predicted secondary structure






























SS confidence




























































Known secondary structure (DSSP)

TT




B
TTSSB


TTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D