Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5dl8B_

Fold library idPDB HeaderMoleculeTitle
c5dl8B_2.20PDB header: membrane proteinChain: B: PDB Molecule: benzoate transport porin benp;


Added to library: Sat Feb 6 08:22:46 2016
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NPNQQTEDEWKFTLKNAYINRDFDNDALKDTGSWSQAASLFYKSKMHDTPLVIADKPITIGADASVQYAV
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
TT


S
SSTTS




TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence RLSSDKHVADTVLPFNKETQSQASDYLKYGATLKLGYDKTLLSVGELWLDLPVTAVDASRQLLTSYWGTN
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
S


SS

SSS
TTTT
STT


SSSS



SSSS

 .........150.........160.........170.........180.........190.........200.........210
Sequence LKSQLSDQLYAEIGRVEKVSPRNEEDFKKFSFTANGITKESDGLNYIDLRYQFTPSLKGEYYFGNLEDLY
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
SSS
TT
SS
B

TT
S
TTTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence NKHYVGLEHTWKQPTFALTSKFKYFNAKDDGNTFDIDAENIGLLETVKVKNHTFGLGYQQIIGESAYPLP
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
SS
SSSSS

TTSSS




 .........290.........300.........310.........320.........330.........340.........350
Sequence DGFLPETYFINWNATGFFKEDEKSYHVMYGYDFKDYIPGLNAMVKYVYGHDFKAANGEKNHETESNVILN
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) SS



TTSTT

SS
S
STT

TTTSTT
TTS
 .........360.........370.........380.........390.
Sequence YAFQQPLLKGFALQYIRIDYNVKHGNDFGEDRLFVNYTKKF
Predicted secondary structure
















SS confidence








































Known secondary structure (DSSP)

SGGGTTSSS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D