Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5dl8B_

Fold library idPDB HeaderMoleculeTitle
c5dl8B_2.20PDB header: membrane proteinChain: B: PDB Molecule: benzoate transport porin benp;


Added to library: Sat Feb 6 08:22:46 2016
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NPNQQTEDEWKFTLKNAYINRDFDNDALKDTGSWSQAASLFYKSKMHDTPLVIADKPITIGADASVQYAV
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
TT


S
SSTTS




TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence RLSSDKHVADTVLPFNKETQSQASDYLKYGATLKLGYDKTLLSVGELWLDLPVTAVDASRQLLTSYWGTN
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
S


SS

SSS
TTTT
STT


SSSS



SSSS

 .........150.........160.........170.........180.........190.........200.........210
Sequence LKSQLSDQLYAEIGRVEKVSPRNEEDFKKFSFTANGITKESDGLNYIDLRYQFTPSLKGEYYFGNLEDLY
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
SSS
TT
SS
B

TT
S
TTTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence NKHYVGLEHTWKQPTFALTSKFKYFNAKDDGNTFDIDAENIGLLETVKVKNHTFGLGYQQIIGESAYPLP
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
SS
SSSSS

TTSSS




 .........290.........300.........310.........320.........330.........340.........350
Sequence DGFLPETYFINWNATGFFKEDEKSYHVMYGYDFKDYIPGLNAMVKYVYGHDFKAANGEKNHETESNVILN
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) SS



TTSTT

SS
S
STT

TTTSTT
TTS
 .........360.........370.........380.........390.
Sequence YAFQQPLLKGFALQYIRIDYNVKHGNDFGEDRLFVNYTKKF
Predicted secondary structure
















SS confidence








































Known secondary structure (DSSP)

SGGGTTSSS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D