Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4bg5B_

Fold library idPDB HeaderMoleculeTitle
c4bg5B_PDB header: membrane proteinChain: B: PDB Molecule: bba65;PDBTitle: lyme disease associated outer surface protein bba65 from2 borrelia burgdorferi


Added to library: Sat Apr 12 08:20:11 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence IDKLFEILAREMTIIKKEKLQTEIPSQFGLKNSMFELLNVYQEKMNSSLAESQKMRRQFYSSLSYNTTDI
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)
S


TTGGGTTTT


TTSSSTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence FNLAEIVNKLYKDPKAHDTIKKISGGIRIQQGFEVALEDLAINMDKLKANDFNKNTLEEIYNLIVDLTLI
Predicted secondary structure


SS confidence





































































Known secondary structure (DSSP) TSGGGTT
TTS
 .........150.........160.........170.........180.........190.........
Sequence KKEWLSTIETLIKSSNATLELQYNTEKLNDHIEQTYKDTMISLCLKSEQTLLHLDTLFK
Predicted secondary structure








SS confidence


























































Known secondary structure (DSSP) TTSS
TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D