Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c2a51A_

Fold library idPDB HeaderMoleculeTitle
c2a51A_PDB header: viral protein,metal binding proteinChain: A: PDB Molecule: nucleocapsid protein;PDBTitle: structure of the (13-51) domain of the nucleocapsid protein2 ncp8 from sivlhoest


Added to library: Wed Jan 9 19:39:41 2013
 
Links to external resources


 1........10.........20.........30.........
Sequence LTCFNCGKPGHTARMCRQPRQEGCWNCGSKEHRFAQCPK
Predicted secondary structure
































SS confidence






































Known secondary structure (DSSP)
B
TTT

BSS
TTT

S


SS
TTT

SSS
TTTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D