Return to main results Retrieve Phyre Job Id

Job DescriptionA1A547
Confidence5.31%DateWed Jul 10 14:22:40 BST 2013
Rank94Aligned Residues36
% Identity14%Templatec2bmxB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:alkyl hydroperoxidase c; PDBTitle: mycobacterium tuberculosis ahpc
Resolution2.4 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   249250.........260.........270.........280.........290.........300.....
Predicted Secondary structure 





























Query SS confidence 
























































Query Sequence  HFLVGQDGEVYEGVGWNIEGSHTYGYNDIALGIAFMGNFVEKPPNEASLKAAQSLIQ
Query Conservation 



  

 





    


  
 
  




 

 
    

  
  
   

 
Alig confidence 











.....................























Template Conservation   



  
 
  .....................             
 
  
  
  
Template Sequence  TFIVDPNNEIQF. . . . . . . . . . . . . . . . . . . . . VSATAGSVGRNVDEVLRVLDALQS
Template Known Secondary structure 
TTSB.....................
TT



Template Predicted Secondary structure 



.....................








Template SS confidence 
























































   135....140...... ...150.........160.........170
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D