Return to main results Retrieve Phyre Job Id

Job DescriptionA1A547
Confidence7.09%DateWed Jul 10 14:22:40 BST 2013
Rank70Aligned Residues37
% Identity24%Templatec2r37A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:glutathione peroxidase 3; PDBTitle: crystal structure of human glutathione peroxidase 3 (selenocysteine to2 glycine mutant)
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   250.........260.........270.........280.........290.........300.........
Predicted Secondary structure 




























Query SS confidence 



























































Query Sequence  FLVGQDGEVYEGVGWNIEGSHTYGYNDIALGIAFMGNFVEKPPNEASLKAAQSLIQCAVA
Query Conservation 


  

 





    


  
 
  




 

 
    

  
  
   

     
Alig confidence 








.........................

























Template Conservation 



  
 
.........................
        
  
   
  

     
Template Sequence  FLVGPDGIP. . . . . . . . . . . . . . . . . . . . . . . . . IMRWHHRTTVSNVKMDILSYMRRQAA
Template Known Secondary structure 
TTS
.........................
TTS
Template Predicted Secondary structure 



.........................




Template SS confidence 



























































   186...190.... .....200.........210.........220
 
   310.
Predicted Secondary structure 

Query SS confidence 

Query Sequence  KG
Query Conservation   
Alig confidence 

Template Conservation   
Template Sequence  LG
Template Known Secondary structure 
Template Predicted Secondary structure 

Template SS confidence 

   221.
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D