Return to main results Retrieve Phyre Job Id

Job DescriptionA1A547
Confidence7.16%DateWed Jul 10 14:22:40 BST 2013
Rank69Aligned Residues40
% Identity20%Templatec1xhoB_
PDB info PDB header:structural genomics, unknown functionChain: B: PDB Molecule:chorismate mutase; PDBTitle: chorismate mutase from clostridium thermocellum cth-682
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   108.110.........120.........130.........140.........150.........160..
Predicted Secondary structure 
























Query SS confidence 






















































Query Sequence  WYVQGLHTQGYNNVSLGIAFFGSKIGSPSPAALSATEDLIFFAIQNGYLSPKYIQ
Query Conservation      


  
 
  



  

 
   
   

 
   

   
    
   
  
Alig confidence 












...............


























Template Conservation   







  

............... 
 
  

 


  

  
 
  



Template Sequence  WAIRGATTVSDNT. . . . . . . . . . . . . . . ADEIVAETQKLLKEXAEKNGLEEDDII
Template Known Secondary structure 
SSS
...............T

GGG
Template Predicted Secondary structure 





...............



Template SS confidence 






















































   3......10..... ....20.........30.........40..
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D