Return to main results Retrieve Phyre Job Id

Job DescriptionA1A547
Confidence25.60%DateWed Jul 10 14:22:40 BST 2013
Rank27Aligned Residues34
% Identity24%Templatec2yzhD_
PDB info PDB header:oxidoreductaseChain: D: PDB Molecule:probable thiol peroxidase; PDBTitle: crystal structure of peroxiredoxin-like protein from aquifex aeolicus
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   250........ .260.........270.........280.........290.........300....
Predicted Secondary structure 



.
























Query SS confidence 








.













































Query Sequence  FLVGQDGEV. YEGVGWNIEGSHTYGYNDIALGIAFMGNFVEKPPNEASLKAAQSLI
Query Conservation 


  

 
.




    


  
 
  




 

 
    

  
  
   

Alig confidence 








.





.....................


















Template Conservation 



  
 
       .....................          

  
  

Template Sequence  FIIDKEGKVAYVQLVP. . . . . . . . . . . . . . . . . . . . . EITEEPNYDEVVNKVKELI
Template Known Secondary structure 
TTSB
S.....................BTTS



Template Predicted Secondary structure 





.....................







Template SS confidence 























































   135....140.........150 .........160.........
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D