Return to main results Retrieve Phyre Job Id

Job DescriptionQ99M51
Confidence20.94%DateTue Jul 30 13:14:31 BST 2013
Rank389Aligned Residues23
% Identity17%Templatec3zf7Z_
PDB info PDB header:ribosomeChain: Z: PDB Molecule:60s ribosomal protein l26, putative; PDBTitle: high-resolution cryo-electron microscopy structure of the trypanosoma2 brucei ribosome
Resolution5.57 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   21........30.........40.........50.
Predicted Secondary structure 















Query SS confidence 






























Query Sequence  LDIKKNERLWLLDDSKSWWRVRNSMNKTGFV
Query Conservation 


  

 
 

   
 

      
  
 
Alig confidence 












........









Template Conservation    




 
 

 ........
  


 


Template Sequence  MPVRKDDEVRVKR. . . . . . . . GKFKGREGRV
Template Known Secondary structure 

SS

S........SSSTT
Template Predicted Secondary structure 


........




Template SS confidence 






























   45....50....... ..60.......
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D