Return to main results Retrieve Phyre Job Id

Job DescriptionA1E960
Confidence1.35%DateWed Jul 10 14:29:05 BST 2013
Rank84Aligned Residues25
% Identity24%Templatec1iebD_
PDB info PDB header:histocompatibility antigenChain: D: PDB Molecule:mhc class ii i-ek; PDBTitle: histocompatibility antigen
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   172.......180.........190.........200......
Predicted Secondary structure 

























Query SS confidence 


































Query Sequence  EQIPFYNQFGFAPPQAEPGVPGGQQHLAFDSFVGT
Query Conservation 





 


  
  


 
 



 



   

Alig confidence 










..........













Template Conservation    
     
 
..........





 

     
Template Sequence  QRVRLLVRYFY. . . . . . . . . . NLEENLRFDSDVGE
Template Known Secondary structure  SS..........TTTTT
S
Template Predicted Secondary structure 
..........






Template SS confidence 


































   22.......30.. .......40......
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D