Return to main results Retrieve Phyre Job Id

Job DescriptionA1E960
Confidence1.35%DateWed Jul 10 14:29:05 BST 2013
Rank86Aligned Residues36
% Identity14%Templatec3r0rA_
PDB info PDB header:virusChain: A: PDB Molecule:porcine circovirus 2 (pcv2) capsid protein; PDBTitle: the 2.3 a structure of porcine circovirus 2
Resolution2.35 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   134.....140.........150.........160.........170.........180.
Predicted Secondary structure 




















Query SS confidence 















































Query Sequence  PQDQTQMFQYYPVYMLLPWEQPQTVTSSPQHTGQQLFEEQIPFYNQFG
Query Conservation 

 











 








  


 
 

  






 


Alig confidence 





















............













Template Conservation 
   
 
 






       ............  
   

 

 

Template Sequence  LQTAGNVDHVGLGTAFENSIYD. . . . . . . . . . . . QEYNIRVTMYVQFR
Template Known Secondary structure 

SS





SS
............
Template Predicted Secondary structure 











............
Template SS confidence 















































   182.......190.........200... ......210.......
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D