Return to main results Retrieve Phyre Job Id

Job DescriptionA1L3T7
Confidence25.27%DateTue Jul 30 12:55:19 BST 2013
Rank164Aligned Residues34
% Identity15%Templatec2eefA_
PDB info PDB header:sugar binding proteinChain: A: PDB Molecule:protein phosphatase 1, regulatory (inhibitor) PDBTitle: solution structure of the cbm_21 domain from human protein2 phosphatase 1, regulatory (inhibitor) subunit 3b
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   203......210.........220.........230.........240.........250
Predicted Secondary structure 
































Query SS confidence 















































Query Sequence  EFQVKMKGLVGYARLCPGDQYEVLMRLGRQRWRLKGRIEPDDSQTWDE
Query Conservation   
   



 





 

 


    
 



  
 
     
 

 
Alig confidence 












...










...........









Template Conservation   
 
 
 

    ...    




 
...........   
 




Template Sequence  TFSFDISLPEKIQ. . . SYERMEFAVYY. . . . . . . . . . . ECNGQTYWDS
Template Known Secondary structure 




S


...TTS

...........TTS
Template Predicted Secondary structure 





...


...........


Template SS confidence 















































   94.....100...... ...110....... ..120.......
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D