Return to main results Retrieve Phyre Job Id

Job DescriptionA1L3T7
Confidence28.99%DateTue Jul 30 12:55:19 BST 2013
Rank153Aligned Residues45
% Identity22%Templatec4aj52_
PDB info PDB header:cell cycleChain: 2: PDB Molecule:spindle and kinetochore-associated protein 3;PDB Fragment:residues 1-121; PDBTitle: crystal structure of the ska core complex
Resolution3.32 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7980.........90.........100....... ..110.........120.........130....
Predicted Secondary structure 

....




Query SS confidence 




























. . . .


























Query Sequence  DALKRGLREHLCEQQAELDYLCGRHTDTQ. . . . RGSRLAFYYDLDKQLRLVERHIRKVEF
Query Conservation    
  

   
   
 
   
        ....




    
  
     

  
  
 
Alig confidence 




























....


.......................
Template Conservation    

     

 
     

   




  
 

  ....................... 
Template Sequence  QTLKDDINILLDKARLENQEGIDFIKATKVLMEKNS. . . . . . . . . . . . . . . . . . . . . . . M
Template Known Secondary structure  .......................
Template Predicted Secondary structure  .......................
Template SS confidence 



























































   52.......60.........70.........80....... .
 
   135....140......
Predicted Secondary structure 
Query SS confidence 











Query Sequence  HISKVDELYEAY
Query Conservation     

 



 
Alig confidence 











Template Conservation 

  


   

Template Sequence  DIMKIREYFQKY
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 











   8990.........100
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D