Return to main results Retrieve Phyre Job Id

Job DescriptionA1L3T7
Confidence28.00%DateTue Jul 30 12:55:19 BST 2013
Rank157Aligned Residues27
% Identity33%Templatec3ifzA_
PDB info PDB header:isomeraseChain: A: PDB Molecule:dna gyrase subunit a; PDBTitle: crystal structure of the first part of the mycobacterium tuberculosis2 dna gyrase reaction core: the breakage and reunion domain at 2.7 a3 resolution
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   227..230.........240.........250.........260.........270
Predicted Secondary structure 





























Query SS confidence 











































Query Sequence  MRLGRQRWRLKGRIEPDDSQTWDEEERVFVPTVHENLEIKVTEL
Query Conservation     
 



  
 
     
 

 

 

 
       




 
Alig confidence 




















.................





Template Conservation     
 
     
         .................
 



Template Sequence  YKTGRGSIRMRGVVEVEEDSR. . . . . . . . . . . . . . . . . LVITEL
Template Known Secondary structure  S







.................

Template Predicted Secondary structure 







.................
Template SS confidence 











































   244.....250.........260.... .....270
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D