Return to main results Retrieve Phyre Job Id

Job DescriptionA1L3T7
Confidence43.71%DateTue Jul 30 12:55:19 BST 2013
Rank124Aligned Residues26
% Identity46%Templatec4he5A_
PDB info PDB header:unknown functionChain: A: PDB Molecule:peptidase family u32; PDBTitle: crystal structure of the selenomethionine variant of the c-terminal2 domain of geobacillus thermoleovorans putative u32 peptidase
Resolution1.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   216...220.........230.........240.........250.........260.........270.
Predicted Secondary structure 



































Query SS confidence 























































Query Sequence  RLCPGDQYEVLMRLGRQRWRLKGRIEPDDSQTWDEEERVFVPTVHENLEIKVTELR
Query Conservation 


 

 


    
 



  
 
     
 

 

 

 
       




 
Alig confidence 








.............................




.











Template Conservation 

  

 

.............................
  
 .       
  
 
Template Sequence  HFRPGDEVE. . . . . . . . . . . . . . . . . . . . . . . . . . . . . FFGPE. IENFTQVIEKIW
Template Known Secondary structure 
B
TT
.............................
TT.S




Template Predicted Secondary structure 





.............................


.


Template SS confidence 























































   362.......370 ..... ....380.......
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D