Return to main results Retrieve Phyre Job Id

Job DescriptionA2A6A1
Confidence26.22%DateWed Jul 10 14:20:06 BST 2013
Rank73Aligned Residues58
% Identity31%Templatec3g6iA_
PDB info PDB header:unknown functionChain: A: PDB Molecule:putative outer membrane protein, part of carbohydrate PDBTitle: crystal structure of an outer membrane protein, part of a putative2 carbohydrate binding complex (bt_1022) from bacteroides3 thetaiotaomicron vpi-5482 at 1.93 a resolution
Resolution1.93 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   124.....130.........140.........150.........160.........170........
Predicted Secondary structure 




.....
Query SS confidence 






















































. . . . .
Query Sequence  AIAKALEDLRANFYCELCDKQYQKHQEFDNHINSYDHAHKQRLKDLKQREFARNV. . . . .
Query Conservation                          


             
        
  
  .....
Alig confidence 




















...........



...............



.....
Template Conservation 

   
  


  
  
 

 ...........  

...............
  
  
  
Template Sequence  KVAEDVCNVIANRYFELNDIY. . . . . . . . . . . EIRD. . . . . . . . . . . . . . . AKVKAVKES
Template Known Secondary structure  ..........................S
Template Predicted Secondary structure  ...........


...............



Template SS confidence 



























































   53......60.........70... .... ..80......
 
   179180.........190........ .200.......
Predicted Secondary structure  .........
Query SS confidence  . . . . . . .



















. .








Query Sequence  . . . . . . . SSRSRKDEKKQEKALRRLHE. . LAEQRKQAE
Query Conservation  .......         

 
       ..  
 
    
Alig confidence  .......



















..








Template Conservation   
   
  

     
  

 
 
 

   
 

  

Template Sequence  GLTGDAKNEALKAAENEKDAALYRSHFAFPASLSLFLN
Template Known Secondary structure  S

STTTT

Template Predicted Secondary structure 








Template SS confidence 





































   87..90.........100.........110.........120....
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D