Return to main results Retrieve Phyre Job Id

Job DescriptionA2A6A1
Confidence22.33%DateWed Jul 10 14:20:06 BST 2013
Rank88Aligned Residues34
% Identity21%Templatec2ig7A_
PDB info PDB header:transferaseChain: A: PDB Molecule:choline/ethanolamine kinase; PDBTitle: crystal structure of human choline kinase b
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   134.....140. ........150........ .160...
Predicted Secondary structure  ...................




...........
Query SS confidence 







. . . . . . . . . . . . . . . . . . .
















. . . . . . . . . . .




Query Sequence  ANFYCELC. . . . . . . . . . . . . . . . . . . DKQYQKHQEFDNHINSY. . . . . . . . . . . DHAHK
Query Conservation          ...................      


        ...........     
Alig confidence 







...................


.....








...........




Template Conservation 

 
 
   

               

  .....    
   
                
Template Sequence  GNHFCEWVYDYTHEEWPFYKARPTDYPTQE. . . . . QQLHFIRHYLAEAKKGETLSQEEQR
Template Known Secondary structure  GGGTT
SSTTS

GGGS

.....TTT



Template Predicted Secondary structure 



















.....









Template SS confidence 



























































   278.280.........290.........300....... ..310.........320.........330..
 
   164.....170..
Predicted Secondary structure 
Query SS confidence 








Query Sequence  QRLKDLKQR
Query Conservation 
        
Alig confidence 








Template Conservation       
   
Template Sequence  KLEEDLLVE
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 








   333......340.
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D