Return to main results Retrieve Phyre Job Id

Job DescriptionA2A6A1
Confidence27.83%DateWed Jul 10 14:20:06 BST 2013
Rank68Aligned Residues24
% Identity17%Templated2chca1
SCOP infoCystatin-like NTF2-like Rv3472-like
Resolution1.69

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   110.........120.........130.........140..
Predicted Secondary structure 
Query SS confidence 
































Query Sequence  ELRQKYKDYVDKEKAIAKALEDLRANFYCELCD
Query Conservation                                   
Alig confidence 










........






.





Template Conservation         
 

........

 
 

.
    
Template Sequence  PVDEQWIEILR. . . . . . . . IQALCAR. YCLTIN
Template Known Secondary structure  .........T
Template Predicted Secondary structure 
.........
Template SS confidence 
































   3......10... ......20 ......
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D