Return to main results Retrieve Phyre Job Id

Job DescriptionA0PJN4
Confidence5.70%DateWed Jul 10 14:10:37 BST 2013
Rank98Aligned Residues23
% Identity22%Templatec1tmxA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:hydroxyquinol 1,2-dioxygenase; PDBTitle: crystal structure of hydroxyquinol 1,2-dioxygenase from2 nocardioides simplex 3e
Resolution1.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   50.........60... ......70..
Predicted Secondary structure 




..................



Query SS confidence 













. . . . . . . . . . . . . . . . . .








Query Sequence  EFILLNLTFPDNFP. . . . . . . . . . . . . . . . . . FSPPFMRVL
Query Conservation    
 
 
 

  

..................  

 
 
 
Alig confidence 













..................








Template Conservation 
 
 
 

 

 



 


 
 

   


  






 
Template Sequence  GGYAFWAITPTPYPIPHDGPVGRMLAATGRSPMRASHLHFM
Template Known Secondary structure  S






SSTT




Template Predicted Secondary structure 



















Template SS confidence 








































   185....190.........200.........210.........220.....
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D