Return to main results Retrieve Phyre Job Id

Job DescriptionA0PJN4
Confidence6.52%DateWed Jul 10 14:10:37 BST 2013
Rank93Aligned Residues24
% Identity21%Templatec3kxtA_
PDB info PDB header:dna binding protein/dnaChain: A: PDB Molecule:chromatin protein cren7; PDBTitle: crystal structure of sulfolobus cren7-dsdna complex
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   28.30.........40.........50.........60....
Predicted Secondary structure 





















Query SS confidence 




































Query Sequence  NVKLHQVDKDSVLWQDMKETNTEFILLNLTFPDNFPF
Query Conservation     
 
  
 
    
        
 
 
 

  

 
Alig confidence 





.






............










Template Conservation 





. 





............

 
 





Template Sequence  KIGLFK. DPETGKY. . . . . . . . . . . . FRHKLPDDYPI
Template Known Secondary structure  .
TTT

............

TT


Template Predicted Secondary structure  .




............






Template SS confidence 




































   37..40.. ....... 50.........60
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D