Return to main results Retrieve Phyre Job Id

Job DescriptionA0PJN4
Confidence6.16%DateWed Jul 10 14:10:37 BST 2013
Rank96Aligned Residues23
% Identity9%Templatec2azqA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:catechol 1,2-dioxygenase; PDBTitle: crystal structure of catechol 1,2-dioxygenase from pseudomonas arvilla2 c-1
Resolution2.65 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   50.........60.. .......70..
Predicted Secondary structure 



..................




Query SS confidence 












. . . . . . . . . . . . . . . . . .









Query Sequence  EFILLNLTFPDNF. . . . . . . . . . . . . . . . . . PFSPPFMRVL
Query Conservation    
 
 
 

  
..................
  

 
 
 
Alig confidence 












..................









Template Conservation 
 
 
 

 

 



 


 
 

   


  






 
Template Sequence  GRYRARSIVPSGYGCDPQGPTQECLDLLGRHGQRPAHVHFF
Template Known Secondary structure 






TTST




Template Predicted Secondary structure 





















Template SS confidence 








































   184.....190.........200.........210.........220....
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D