Return to main results Retrieve Phyre Job Id

Job DescriptionA2A5R2
Confidence24.52%DateWed Jul 10 14:14:35 BST 2013
Rank88Aligned Residues42
% Identity26%Templatec2ad5B_
PDB info PDB header:ligaseChain: B: PDB Molecule:ctp synthase; PDBTitle: mechanisms of feedback regulation and drug resistance of ctp2 synthetases: structure of the e. coli ctps/ctp complex at 2.8-3 angstrom resolution.
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   695....700.........710.........720.. .......730.....
Predicted Secondary structure 









...................





Query SS confidence 



























. . . . . . . . . . . . . . . . . . .












Query Sequence  LDSTQVGEFLGDSTRFNKEVMYAYVDQL. . . . . . . . . . . . . . . . . . . DFCEKEFVSALRT
Query Conservation 


  





     
  

  

   ...................

       


 
Alig confidence 



























...................












Template Conservation 
 


 
 


 






 
  
   
       
  
 
 








  
 

  
Template Sequence  LRKERRGDYLGATVQVIPHITNAIKERVLEGGEGHDVVLVEIGGTVGDIESLPFLEAIRQ
Template Known Secondary structure  TTTTTT



TTTSS
STTSSTT
Template Predicted Secondary structure 



























Template SS confidence 



























































   100.........110.........120.........130.........140.........150.........
 
   736
Predicted Secondary structure 
Query SS confidence 
Query Sequence  F
Query Conservation 
Alig confidence 
Template Conservation   
Template Sequence  M
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 
   160
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D