Return to main results Retrieve Phyre Job Id

Job DescriptionA2A699
Confidence32.70%DateWed Jul 10 14:20:28 BST 2013
Rank73Aligned Residues50
% Identity32%Templated1jb0l_
SCOP infoPhotosystem I reaction center subunit XI, PsaL Photosystem I reaction center subunit XI, PsaL Photosystem I reaction center subunit XI, PsaL
Resolution2.50

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   288.290.........300.........310......... 320.........
Predicted Secondary structure 



















..................
Query SS confidence 































. . . . . . . . . . . . . . . . . .









Query Sequence  YWVAAMASPTSGLVTITSGIQDIGTYHTIFLL. . . . . . . . . . . . . . . . . . TILAALALLV
Query Conservation 




 
    
         

  


 


..................




 



Alig confidence 



















.










..................









Template Conservation   

 


 

 



  


.









 


  




 
  
 










 
Template Sequence  TFIGNLPAYRQGLSPILRGL. EVGMAHGYFLIGPWVKLGPLRDSDVANLGGLISGIALIL
Template Known Secondary structure  TSTTT
TT

.TSTTTTSTT
Template Predicted Secondary structure 






.






Template SS confidence 



























































   2930.........40........ .50.........60.........70.........80.......
 
   330........
Predicted Secondary structure 
Query SS confidence 








Query Sequence  LILLCLLIY
Query Conservation 
 






Alig confidence 








Template Conservation 


  

 
Template Sequence  VATACLAAY
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 








   88.90......
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D