Return to main results Retrieve Phyre Job Id

Job DescriptionA1Y9I9
Confidence84.40%DateWed Jul 10 14:16:46 BST 2013
Rank354Aligned Residues36
% Identity31%Templatec4guaB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:non-structural polyprotein; PDBTitle: alphavirus p23pro-zbd
Resolution2.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   174.....180.........190........ .200.........
Predicted Secondary structure 





............






Query SS confidence 
























. . . . . . . . . . . .










Query Sequence  NRADLVLLAHRPRYYLRDLQLLEAH. . . . . . . . . . . . ALLPHGATVLA
Query Conservation    







 
  
   
 


  ............ 

  





Alig confidence 
























............










Template Conservation   








 

 
 









 




   

  
 


 
 
Template Sequence  ARYDLVFINIGTKYRNHHFQQCEDHAATLKTLSRSALNCLNPGGTLVV
Template Known Secondary structure 








S
T
Template Predicted Secondary structure 














Template SS confidence 















































   1225....1230.........1240.........1250.........1260.........1270..
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D