Return to main results Retrieve Phyre Job Id

Job DescriptionA2A5K6
Confidence80.97%DateTue Jul 30 13:04:49 BST 2013
Rank264Aligned Residues24
% Identity29%Templatec3t7lA_
PDB info PDB header:transport proteinChain: A: PDB Molecule:zinc finger fyve domain-containing protein 16; PDBTitle: crystal structure of the fyve domain of endofin (zfyve16) at 1.1a2 resolution
Resolution1.09 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1077..1080.........1090.........1100.........1110..
Predicted Secondary structure 






















Query SS confidence 



































Query Sequence  CNQCSFASKNKKDLRRHMLTHTNEKPFSCHVCGQRF
Query Conservation 
  
   
     
  
   
       
  
   
Alig confidence 








............














Template Conservation 
  
   
 ............   

  

 

   
Template Sequence  CMNCQVKFT. . . . . . . . . . . . FTKRRHHCRACGKVF
Template Known Secondary structure 
TTT

B

............SSS


TTT

Template Predicted Secondary structure 








............








Template SS confidence 



































   753......760. ........770......
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D