Return to main results Retrieve Phyre Job Id

Job DescriptionA2A5K6
Confidence82.93%DateTue Jul 30 13:04:49 BST 2013
Rank252Aligned Residues30
% Identity23%Templatec1s1i9_
PDB info PDB header:ribosomeChain: 9: PDB Molecule:60s ribosomal protein l43; PDBTitle: structure of the ribosomal 80s-eef2-sordarin complex from2 yeast obtained by docking atomic models for rna and protein3 components into a 11.7 a cryo-em map. this file, 1s1i,4 contains 60s subunit. the 40s ribosomal subunit is in file5 1s1h.
Resolution11.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1045....1050.........1060.........1070.........1080....
Predicted Secondary structure 


























Query SS confidence 







































Query Sequence  AAFKCPDCPFSARQWPEVRAHMAQHSSLRPHQCNQCSFAS
Query Conservation      
  
         
  
   
       
  
   
Alig confidence 
















..........












Template Conservation    
 

 


  


  .......... 


 
 


   
Template Sequence  ARYDCSFCGKKTVKRGA. . . . . . . . . . AGIWTCSCCKKTV
Template Known Secondary structure  S



TTT
SS


T..........TT

SSS


Template Predicted Secondary structure 










..........




Template SS confidence 







































   34.....40.........50 .........60...
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D