Return to main results Retrieve Phyre Job Id

Job DescriptionA2A5K6
Confidence79.29%DateTue Jul 30 13:04:49 BST 2013
Rank277Aligned Residues30
% Identity20%Templatec3cc4Z_
PDB info PDB header:ribosomeChain: Z: PDB Molecule:50s ribosomal protein l37ae; PDBTitle: co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1045....1050.........1060.........1070.........1080....
Predicted Secondary structure 


























Query SS confidence 







































Query Sequence  AAFKCPDCPFSARQWPEVRAHMAQHSSLRPHQCNQCSFAS
Query Conservation      
  
         
  
   
       
  
   
Alig confidence 
















..........












Template Conservation    
 

 


  


  .......... 


 
 


   
Template Sequence  EDHACPNCGEDRVDRQG. . . . . . . . . . TGIWQCSYCDYKF
Template Known Secondary structure  S

SSS


S..........SSTTT

Template Predicted Secondary structure 










..........




Template SS confidence 







































   5960.........70..... ....80........
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D