Return to main results Retrieve Phyre Job Id

Job DescriptionA2A5K6
Confidence86.96%DateTue Jul 30 13:04:49 BST 2013
Rank235Aligned Residues23
% Identity22%Templatec1dvbA_
PDB info PDB header:electron transportChain: A: PDB Molecule:rubrerythrin; PDBTitle: rubrerythrin
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1075....1080.........1090.........1100.........
Predicted Secondary structure 



















Query SS confidence 


































Query Sequence  HQCNQCSFASKNKKDLRRHMLTHTNEKPFSCHVCG
Query Conservation    
  
   
     
  
   
       
  
 
Alig confidence 










............











Template Conservation    
  

    ............
   
  

 
 
Template Sequence  WRCRNCGYVHE. . . . . . . . . . . . GTGAPELCPACA
Template Known Secondary structure  TTT

............

SB
TTT
Template Predicted Secondary structure 




............











Template SS confidence 


































   156...160...... ...170........
 
Download:Text version FASTA version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions
Phyre2 is part of Genome3D