Return to main results Retrieve Phyre Job Id

Job DescriptionQ96FX8
Confidence3.41%DateFri May 25 09:35:23 BST 2012
Rank62Aligned Residues37
% Identity11%Templatec2ww9B_
PDB info PDB header:ribosomeChain: B: PDB Molecule:protein transport protein sss1; PDBTitle: cryo-em structure of the active yeast ssh1 complex bound to the2 yeast 80s ribosome
Resolution8.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   47..50.........60.........70.........80.........90.......
Predicted Secondary structure 


















Query SS confidence 


















































Query Sequence  LWWKCSQEGGGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFF
Query Conservation 

  
                        
  
  
 
 
      
    
Alig confidence 








..............



























Template Conservation 
 


 


.............. 


  
  
  


 


 


 



Template Sequence  FLAKCKKPD. . . . . . . . . . . . . . LKEYTKIVKAVGIGFIAVGIIGYAIKLI
Template Known Secondary structure  S




..............
Template Predicted Secondary structure 



..............
Template SS confidence 


















































   35....40... ......50.........60.........70.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions