Return to main results Retrieve Phyre Job Id

Job DescriptionP16333
Confidence21.86%DateSat Jun 16 10:34:35 BST 2012
Rank373Aligned Residues23
% Identity17%Templatec4a1cS_
PDB info PDB header:ribosomeChain: S: PDB Molecule:rpl26; PDBTitle: t.thermophila 60s ribosomal subunit in complex with2 initiation factor 6. this file contains 5s rrna,3 5.8s rrna and proteins of molecule 4.
Resolution3.52 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   21........30.........40.........50.
Predicted Secondary structure 















Query SS confidence 






























Query Sequence  LDIKKNERLWLLDDSKSWWRVRNSMNKTGFV
Query Conservation 


  

 
 

   
 

      
  
 
Alig confidence 












........









Template Conservation    




 
 

 ........
  


 


Template Sequence  MPVRKDDEVLIVR. . . . . . . . GKFKGNKGKV
Template Known Secondary structure 

TT

S........STTTT
Template Predicted Secondary structure 


........




Template SS confidence 






























   47..50......... 60.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions